Lineage for d2hqka_ (2hqk A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199567Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1199568Protein automated matches [190526] (11 species)
    not a true protein
  7. 1199585Species Clavularia sp. [TaxId:86521] [188532] (3 PDB entries)
  8. 1199586Domain d2hqka_: 2hqk A: [165209]
    automated match to d1mova_
    complexed with act, cl, zn

Details for d2hqka_

PDB Entry: 2hqk (more details), 1.19 Å

PDB Description: Crystal structure of a monomeric cyan fluorescent protein derived from Clavularia
PDB Compounds: (A:) Cyan fluorescent chromoprotein

SCOPe Domain Sequences for d2hqka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqka_ d.22.1.0 (A:) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydilttaf
xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlkge
nfppngpvmqkkttgwdastermyvrdgvlkgdvkhkllleggghhrvdfktiyrakkav
klpdyhfvdhrieilnhdkdynkvtvyesavarn

SCOPe Domain Coordinates for d2hqka_:

Click to download the PDB-style file with coordinates for d2hqka_.
(The format of our PDB-style files is described here.)

Timeline for d2hqka_: