SCOPe 2.02: Domain d2hq8a_: 2hq8 A:

Lineage for d2hq8a_ (2hq8 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (5 species)
   not a true protein

7. Species Renilla muelleri [TaxId:37510] [187819] (2 PDB entries)

8. Domain d2hq8a_: 2hq8 A: [165206]
   automated match to d1q80a_
   complexed with ca

Details for d2hq8a_

PDB Entry: 2hq8, 1.8 Å

PDB Description: Crystal structure of coelenterazine-binding protein from renilla muelleri in the ca loaded apo form

PDB Compounds: (A:) Coelenterazine-binding protein ca-bound apo form

SCOPe Domain Sequences for d2hq8a_:

Sequence; same for both SEQRES and ATOM records:

>d2hq8a_ a.39.1.0 (A:) automated matches {Renilla muelleri [TaxId: 37510]}
iteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqeflr
vadqlglapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvslpe
fkaflqavgpdltddkaitcfntldfnkngqisrdeflvtvndflfgleetalanafygd
l

Timeline for d2hq8a_:

• d2hq8a_ first appeared in SCOPe 2.01
  
• d2hq8a_ appears in SCOPe 2.03
  
• d2hq8a_ appears in the current release, SCOPe 2.08