Lineage for d2hpsa_ (2hps A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 915090Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 915091Protein automated matches [190513] (5 species)
    not a true protein
  7. 915100Species Renilla muelleri [TaxId:37510] [187819] (2 PDB entries)
  8. 915101Domain d2hpsa_: 2hps A: [165203]
    automated match to d1q80a_
    complexed with ctz, gol

Details for d2hpsa_

PDB Entry: 2hps (more details), 1.72 Å

PDB Description: Crystal structure of coelenterazine-binding protein from Renilla Muelleri
PDB Compounds: (A:) coelenterazine-binding protein with bound coelenterazine

SCOPe Domain Sequences for d2hpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hpsa_ a.39.1.0 (A:) automated matches {Renilla muelleri [TaxId: 37510]}
eiteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqefl
rvadqlglapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvslp
efkaflqavgpdltddkaitcfntldfnkngqisrdeflvtvndflfgleetalanafyg
dlvd

SCOPe Domain Coordinates for d2hpsa_:

Click to download the PDB-style file with coordinates for d2hpsa_.
(The format of our PDB-style files is described here.)

Timeline for d2hpsa_: