Lineage for d1om2a_ (1om2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699404Superfamily a.23.4: Mitochondrial import receptor subunit Tom20 [47157] (1 family) (S)
  5. 2699405Family a.23.4.1: Mitochondrial import receptor subunit Tom20 [47158] (1 protein)
  6. 2699406Protein Mitochondrial import receptor subunit Tom20 [47159] (1 species)
  7. 2699407Species Norway rat (Rattus norvegicus) [TaxId:10116] [47160] (1 PDB entry)
  8. 2699408Domain d1om2a_: 1om2 A: [16520]

Details for d1om2a_

PDB Entry: 1om2 (more details)

PDB Description: solution nmr structure of the mitochondrial protein import receptor tom20 from rat in a complex with a presequence peptide derived from rat aldehyde dehydrogenase (aldh)
PDB Compounds: (A:) protein (mitochondrial import receptor subunit tom20)

SCOPe Domain Sequences for d1om2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
raglsklpdlkdaeavqkffleeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqvl
qqtlpppvfqmlltklptisqrivsaqslgeddve

SCOPe Domain Coordinates for d1om2a_:

Click to download the PDB-style file with coordinates for d1om2a_.
(The format of our PDB-style files is described here.)

Timeline for d1om2a_: