Class a: All alpha proteins [46456] (289 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) duplication: consists of two domains of this fold automatically mapped to Pfam PF02964 |
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins) |
Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
Species Methylosinus trichosporium [TaxId:426] [47156] (2 PDB entries) |
Domain d1mhzg_: 1mhz G: [16519] Other proteins in same PDB: d1mhzb_, d1mhzd_ complexed with fe |
PDB Entry: 1mhz (more details), 2.7 Å
SCOPe Domain Sequences for d1mhzg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhzg_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylosinus trichosporium [TaxId: 426]} akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq
Timeline for d1mhzg_: