Lineage for d2hp2a_ (2hp2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2132073Species Synechococcus elongatus [TaxId:269084] [187818] (8 PDB entries)
  8. 2132087Domain d2hp2a_: 2hp2 A: [165189]
    automated match to d2gsaa_
    complexed with hoz, ke4, plp

Details for d2hp2a_

PDB Entry: 2hp2 (more details), 2.7 Å

PDB Description: Inter-subunit signaling in GSAM
PDB Compounds: (A:) Glutamate-1-semialdehyde 2,1-aminomutase (GSAM) hybrid-form

SCOPe Domain Sequences for d2hp2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hp2a_ c.67.1.4 (A:) automated matches {Synechococcus elongatus [TaxId: 269084]}
fktiksdeifaaaqklmpggvsspvrafksvggqpivfdrvkdayawdvdgnryidyvgt
wgpaicghahpeviealkvamekgtsfgapcalenvlaemvndavpsiemvrfvnsgtea
cmavlrimraytgrdkiikfegcyhghadmflvkagsgvatlglpsspgvpkkttantlt
tpyndleavkalfaenpgeiagvilepivgnsgfivpdagfleglreitlehdallvfde
vmtgfriayggvqekfgvtpdlttlgkiiggglpvgayggkreimqlvapagpmyqagtl
sgnplamtagiktlellrqpgtyeyldqitkrlsdgllaiaqetghaacggqvsgmfgff
ftegpvhnyedakksdlqkfsrfhrgmleqgiylapsqfeagftslahteedidatlaaa
rtvmsal

SCOPe Domain Coordinates for d2hp2a_:

Click to download the PDB-style file with coordinates for d2hp2a_.
(The format of our PDB-style files is described here.)

Timeline for d2hp2a_: