Lineage for d1mhyg_ (1mhy G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312626Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2312673Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 2312674Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)
  6. 2312675Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 2312733Species Methylosinus trichosporium [TaxId:426] [47156] (2 PDB entries)
  8. 2312734Domain d1mhyg_: 1mhy G: [16518]
    Other proteins in same PDB: d1mhyb_, d1mhyd_
    complexed with fe

Details for d1mhyg_

PDB Entry: 1mhy (more details), 2 Å

PDB Description: methane monooxygenase hydroxylase
PDB Compounds: (G:) methane monooxygenase hydroxylase

SCOPe Domain Sequences for d1mhyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhyg_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylosinus trichosporium [TaxId: 426]}
akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp
pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq

SCOPe Domain Coordinates for d1mhyg_:

Click to download the PDB-style file with coordinates for d1mhyg_.
(The format of our PDB-style files is described here.)

Timeline for d1mhyg_: