![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies) core: 3 helices; bundle, open |
![]() | Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) ![]() duplication: consists of two domains of this fold |
![]() | Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
![]() | Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
![]() | Species Methylosinus trichosporium [TaxId:426] [47156] (2 PDB entries) |
![]() | Domain d1mhyg_: 1mhy G: [16518] Other proteins in same PDB: d1mhyb_, d1mhyd_ complexed with fe |
PDB Entry: 1mhy (more details), 2 Å
SCOP Domain Sequences for d1mhyg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhyg_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylosinus trichosporium} akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq
Timeline for d1mhyg_: