Lineage for d1mhyg_ (1mhy G:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535400Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
    core: 3 helices; bundle, open
  4. 535431Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 535432Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 535433Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 535465Species Methylosinus trichosporium [TaxId:426] [47156] (2 PDB entries)
  8. 535466Domain d1mhyg_: 1mhy G: [16518]
    Other proteins in same PDB: d1mhyb_, d1mhyd_
    complexed with fe

Details for d1mhyg_

PDB Entry: 1mhy (more details), 2 Å

PDB Description: methane monooxygenase hydroxylase
PDB Compounds: (G:)

SCOP Domain Sequences for d1mhyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhyg_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylosinus trichosporium}
akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp
pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq

SCOP Domain Coordinates for d1mhyg_:

Click to download the PDB-style file with coordinates for d1mhyg_.
(The format of our PDB-style files is described here.)

Timeline for d1mhyg_: