Lineage for d2hoqa_ (2hoq A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1629211Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1629212Protein automated matches [190447] (45 species)
    not a true protein
  7. 1629522Species Pyrococcus horikoshii [TaxId:70601] [187354] (3 PDB entries)
  8. 1629523Domain d2hoqa_: 2hoq A: [165178]
    automated match to d1x42a1

Details for d2hoqa_

PDB Entry: 2hoq (more details), 1.7 Å

PDB Description: Crystal structure of the probable haloacid dehalogenase (PH1655) from pyrococcus horikoshii OT3
PDB Compounds: (A:) Putative HAD-hydrolase PH1655

SCOPe Domain Sequences for d2hoqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hoqa_ c.108.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mvkviffdlddtlvdtsklaeiarknaienmirhglpvdfetayselielikeygsnfpy
hfdyllrrldlpynpkwisagviayhntkfaylrevpgarkvlirlkelgyelgiitdgn
pvkqwekilrlelddffehviisdfegvkkphpkifkkalkafnvkpeealmvgdrlysd
iygakrvgmktvwfrygkhsereleyrkyadyeidnlesllevlaresssnkkvhpp

SCOPe Domain Coordinates for d2hoqa_:

Click to download the PDB-style file with coordinates for d2hoqa_.
(The format of our PDB-style files is described here.)

Timeline for d2hoqa_: