| Class b: All beta proteins [48724] (180 folds) |
| Fold b.9: Neurophysin II [49605] (1 superfamily) sandwich; 8 strands in 2 sheets; meander |
Superfamily b.9.1: Neurophysin II [49606] (1 family) ![]() duplication: composed of two structural repeats automatically mapped to Pfam PF00184 |
| Family b.9.1.1: Neurophysin II [49607] (1 protein) |
| Protein Neurophysin II [49608] (1 species) can be classified as disulfide-rich |
| Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries) |
| Domain d2hnwd_: 2hnw D: [165175] automated match to d1l5ca_ mutant |
PDB Entry: 2hnw (more details), 2.9 Å
SCOPe Domain Sequences for d2hnwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hnwd_ b.9.1.1 (D:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccspdgchedpacd
Timeline for d2hnwd_:
View in 3DDomains from other chains: (mouse over for more information) d2hnwa_, d2hnwb_, d2hnwc_, d2hnwe_ |