Lineage for d2hnud_ (2hnu D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941658Fold b.9: Neurophysin II [49605] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 941659Superfamily b.9.1: Neurophysin II [49606] (1 family) (S)
    duplication: composed of two structural repeats
  5. 941660Family b.9.1.1: Neurophysin II [49607] (2 proteins)
  6. 941674Protein automated matches [190688] (1 species)
    not a true protein
  7. 941675Species Cow (Bos taurus) [TaxId:9913] [187816] (3 PDB entries)
  8. 941679Domain d2hnud_: 2hnu D: [165165]
    automated match to d1l5ca_
    complexed with phe

Details for d2hnud_

PDB Entry: 2hnu (more details), 2 Å

PDB Description: crystal structure of a dipeptide complex of bovine neurophysin-i
PDB Compounds: (D:) Oxytocin-neurophysin 1

SCOPe Domain Sequences for d2hnud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hnud_ b.9.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccspdgchedpacdp

SCOPe Domain Coordinates for d2hnud_:

Click to download the PDB-style file with coordinates for d2hnud_.
(The format of our PDB-style files is described here.)

Timeline for d2hnud_: