Class b: All beta proteins [48724] (174 folds) |
Fold b.9: Neurophysin II [49605] (1 superfamily) sandwich; 8 strands in 2 sheets; meander |
Superfamily b.9.1: Neurophysin II [49606] (1 family) duplication: composed of two structural repeats |
Family b.9.1.1: Neurophysin II [49607] (2 proteins) |
Protein automated matches [190688] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187816] (3 PDB entries) |
Domain d2hnud_: 2hnu D: [165165] automated match to d1l5ca_ complexed with phe |
PDB Entry: 2hnu (more details), 2 Å
SCOPe Domain Sequences for d2hnud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hnud_ b.9.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]} vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr caaagiccspdgchedpacdp
Timeline for d2hnud_:
View in 3D Domains from other chains: (mouse over for more information) d2hnua_, d2hnub_, d2hnuc_, d2hnue_ |