SCOPe 2.06: Domain d2hnub_: 2hnu B:

Lineage for d2hnub_ (2hnu B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.9: Neurophysin II [49605] (1 superfamily)
   sandwich; 8 strands in 2 sheets; meander

4. Superfamily b.9.1: Neurophysin II [49606] (1 family)
   duplication: composed of two structural repeats
   automatically mapped to Pfam PF00184

5. Family b.9.1.1: Neurophysin II [49607] (1 protein)

6. Protein Neurophysin II [49608] (1 species)
   can be classified as disulfide-rich

7. Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)

8. Domain d2hnub_: 2hnu B: [165163]
   automated match to d1l5ca_
   complexed with phe

Details for d2hnub_

PDB Entry: 2hnu, 2 Å

PDB Description: crystal structure of a dipeptide complex of bovine neurophysin-i

PDB Compounds: (B:) Oxytocin-neurophysin 1

SCOPe Domain Sequences for d2hnub_:

Sequence; same for both SEQRES and ATOM records:

>d2hnub_ b.9.1.1 (B:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccspdgchedpacdp

Timeline for d2hnub_:

• d2hnub_ first appeared in SCOPe 2.01
  
• d2hnub_ appears in SCOPe 2.05
  
• d2hnub_ appears in SCOPe 2.07
  
• d2hnub_ appears in the current release, SCOPe 2.08