Lineage for d2hnkc1 (2hnk C:3-231)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130765Species Leptospira interrogans [TaxId:173] [187817] (1 PDB entry)
  8. 2130768Domain d2hnkc1: 2hnk C:3-231 [165161]
    Other proteins in same PDB: d2hnka2, d2hnkb2, d2hnkc2
    automated match to d1suia1
    complexed with peg, sah, so4

Details for d2hnkc1

PDB Entry: 2hnk (more details), 2.3 Å

PDB Description: crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans
PDB Compounds: (C:) SAM-dependent O-methyltransferase

SCOPe Domain Sequences for d2hnkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hnkc1 c.66.1.0 (C:3-231) automated matches {Leptospira interrogans [TaxId: 173]}
rknisltesleeyifrnsvrepdsflklrketgtlaqanmqispeegqflniltkisgak
riieigtftgysslcfasalpedgkilccdvseewtnvarkywkenglenkiflklgsal
etlqvlidsksapswasdfafgpssidlffldadkenypnyyplilkllkpgglliadnv
lwdgsvadlshqepstvgirkfnelvyndslvdvslvpiadgvslvrkr

SCOPe Domain Coordinates for d2hnkc1:

Click to download the PDB-style file with coordinates for d2hnkc1.
(The format of our PDB-style files is described here.)

Timeline for d2hnkc1: