SCOPe 2.08: Domain d2hnkc1: 2hnk C:3-231

Lineage for d2hnkc1 (2hnk C:3-231)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Leptospira interrogans [TaxId:173] [187817] (1 PDB entry)

8. Domain d2hnkc1: 2hnk C:3-231 [165161]
   Other proteins in same PDB: d2hnka2, d2hnkb2, d2hnkc2
   automated match to d1suia1
   complexed with peg, sah, so4

Details for d2hnkc1

PDB Entry: 2hnk, 2.3 Å

PDB Description: crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans

PDB Compounds: (C:) SAM-dependent O-methyltransferase

SCOPe Domain Sequences for d2hnkc1:

Sequence; same for both SEQRES and ATOM records:

>d2hnkc1 c.66.1.0 (C:3-231) automated matches {Leptospira interrogans [TaxId: 173]}
rknisltesleeyifrnsvrepdsflklrketgtlaqanmqispeegqflniltkisgak
riieigtftgysslcfasalpedgkilccdvseewtnvarkywkenglenkiflklgsal
etlqvlidsksapswasdfafgpssidlffldadkenypnyyplilkllkpgglliadnv
lwdgsvadlshqepstvgirkfnelvyndslvdvslvpiadgvslvrkr

Timeline for d2hnkc1:

• d2hnkc1 first appeared in SCOPe 2.01, called d2hnkc_
  
• d2hnkc1 appears in SCOPe 2.07