SCOPe 2.08: Domain d2hm7a_: 2hm7 A:

Lineage for d2hm7a_ (2hm7 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Carboxylesterase [53488] (3 species)
   bacterial homologue of human hormone sensitive lipase

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [53490] (4 PDB entries)
   Uniprot Q7SIG1

8. Domain d2hm7a_: 2hm7 A: [165152]
   automated match to d1evqa_
   complexed with so4; mutant

Details for d2hm7a_

PDB Entry: 2hm7, 2 Å

PDB Description: crystal structure analysis of the g84s est2 mutant

PDB Compounds: (A:) carboxylesterase

SCOPe Domain Sequences for d2hm7a_:

Sequence; same for both SEQRES and ATOM records:

>d2hm7a_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtlkv
rmyrpegveppypalvyyhggswvvgdlethdpvcrvlakdgravvfsvdyrlapehkfp
aavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafqlli
ypstgydpahppasieenaegylltggmmlwfrdqylnsleelthpwfspvlypdlsglp
payiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvria
eklrdala

Timeline for d2hm7a_:

• d2hm7a_ first appeared in SCOPe 2.01
  
• d2hm7a_ appears in SCOPe 2.07