Lineage for d1fz4e_ (1fz4 E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535400Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
    core: 3 helices; bundle, open
  4. 535431Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 535432Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 535433Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 535434Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)
  8. 535459Domain d1fz4e_: 1fz4 E: [16514]
    Other proteins in same PDB: d1fz4a_, d1fz4b_, d1fz4c_, d1fz4d_

Details for d1fz4e_

PDB Entry: 1fz4 (more details), 2.38 Å

PDB Description: methane monooxygenase hydroxylase, form iii soaked at ph 8.5 (0.1 m tris)

SCOP Domain Sequences for d1fz4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz4e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOP Domain Coordinates for d1fz4e_:

Click to download the PDB-style file with coordinates for d1fz4e_.
(The format of our PDB-style files is described here.)

Timeline for d1fz4e_: