Lineage for d2hldg_ (2hld G:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170081Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1170197Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1170228Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 1170229Protein automated matches [190687] (1 species)
    not a true protein
  7. 1170230Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (3 PDB entries)
  8. 1170232Domain d2hldg_: 2hld G: [165136]
    automated match to d1bmfg_
    complexed with anp, mg, po4

Details for d2hldg_

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (G:) ATP synthase gamma chain, mitochondrial

SCOPe Domain Sequences for d2hldg_:

Sequence, based on SEQRES records: (download)

>d2hldg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgass

Sequence, based on observed residues (ATOM records): (download)

>d2hldg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
silynrtrqavitnelvdiitgass

SCOPe Domain Coordinates for d2hldg_:

Click to download the PDB-style file with coordinates for d2hldg_.
(The format of our PDB-style files is described here.)

Timeline for d2hldg_: