| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family) ![]() similar structure to L29p (46561); contains extra short helix; forms homodimer: an open bundle |
| Family a.2.13.1: Transcriptional repressor TraM [109632] (2 proteins) |
| Protein automated matches [190685] (1 species) not a true protein |
| Species Agrobacterium tumefaciens [TaxId:358] [187813] (1 PDB entry) |
| Domain d2hjdd_: 2hjd D: [165129] automated match to d1upgb_ |
PDB Entry: 2hjd (more details), 2.1 Å
SCOPe Domain Sequences for d2hjdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hjdd_ a.2.13.1 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
felrpvigltrglssadietltanairlhrqllekadqlfqvlpddikigtaaggeqhle
yieamiemhaqmsavntlvgllgfipkvsv
Timeline for d2hjdd_: