Lineage for d2hjdc_ (2hjd C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904600Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family) (S)
    similar structure to L29p (46561); contains extra short helix; forms homodimer: an open bundle
  5. 904601Family a.2.13.1: Transcriptional repressor TraM [109632] (2 proteins)
  6. 904610Protein automated matches [190685] (1 species)
    not a true protein
  7. 904611Species Agrobacterium tumefaciens [TaxId:358] [187813] (1 PDB entry)
  8. 904614Domain d2hjdc_: 2hjd C: [165128]
    automated match to d1upgb_

Details for d2hjdc_

PDB Entry: 2hjd (more details), 2.1 Å

PDB Description: Crystal structure of a second quorum sensing antiactivator TraM2 from A. tumefaciens strain A6
PDB Compounds: (C:) Quorum-sensing antiactivator

SCOPe Domain Sequences for d2hjdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjdc_ a.2.13.1 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
felrpvigltrglssadietltanairlhrqllekadqlfqvlpddikigtaaggeqhle
yieamiemhaqmsavntlvgllgfipkvs

SCOPe Domain Coordinates for d2hjdc_:

Click to download the PDB-style file with coordinates for d2hjdc_.
(The format of our PDB-style files is described here.)

Timeline for d2hjdc_: