Lineage for d2hjda_ (2hjd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2304108Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family) (S)
    similar structure to L29p (46561); contains extra short helix; forms homodimer: an open bundle
    automatically mapped to Pfam PF09228
  5. 2304109Family a.2.13.1: Transcriptional repressor TraM [109632] (2 proteins)
  6. 2304118Protein automated matches [190685] (1 species)
    not a true protein
  7. 2304119Species Agrobacterium tumefaciens [TaxId:358] [187813] (1 PDB entry)
  8. 2304120Domain d2hjda_: 2hjd A: [165126]
    automated match to d1upgb_

Details for d2hjda_

PDB Entry: 2hjd (more details), 2.1 Å

PDB Description: Crystal structure of a second quorum sensing antiactivator TraM2 from A. tumefaciens strain A6
PDB Compounds: (A:) Quorum-sensing antiactivator

SCOPe Domain Sequences for d2hjda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjda_ a.2.13.1 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
felrpvigltrglssadietltanairlhrqllekadqlfqvlpddikigtaaggeqhle
yieamiemhaqmsavntlvgllgfipkvs

SCOPe Domain Coordinates for d2hjda_:

Click to download the PDB-style file with coordinates for d2hjda_.
(The format of our PDB-style files is described here.)

Timeline for d2hjda_: