SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2hjda_ (2hjd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980254Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family) (S)
    similar structure to L29p (46561); contains extra short helix; forms homodimer: an open bundle
    automatically mapped to Pfam PF09228
  5. 1980255Family a.2.13.1: Transcriptional repressor TraM [109632] (2 protein domains)
  6. 1980264Protein automated matches [190685] (1 species)
    not a true protein
  7. 1980265Species Agrobacterium tumefaciens [TaxId:358] [187813] (1 PDB entry)
  8. 1980266Domain d2hjda_: 2hjd A: [165126]
    automated match to d1upgb_

Details for d2hjda_

PDB Entry: 2hjd (more details), 2.1 Å

PDB Description: Crystal structure of a second quorum sensing antiactivator TraM2 from A. tumefaciens strain A6
PDB Compounds: (A:) Quorum-sensing antiactivator

SCOPe Domain Sequences for d2hjda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjda_ a.2.13.1 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
felrpvigltrglssadietltanairlhrqllekadqlfqvlpddikigtaaggeqhle
yieamiemhaqmsavntlvgllgfipkvs

SCOPe Domain Coordinates for d2hjda_:

Click to download the PDB-style file with coordinates for d2hjda_.
(The format of our PDB-style files is described here.)

Timeline for d2hjda_: