SCOPe 2.01: Domain d2hj3b_: 2hj3 B:

Lineage for d2hj3b_ (2hj3 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.0: automated matches [191449] (1 protein)
   not a true family

6. Protein automated matches [190684] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187812] (1 PDB entry)

8. Domain d2hj3b_: 2hj3 B: [165121]
   automated match to d1oqca_
   complexed with fad, so4

Details for d2hj3b_

PDB Entry: 2hj3, 2.5 Å

PDB Description: Structure of the Arabidopsis Thaliana Erv1 Thiol Oxidase

PDB Compounds: (B:) Sulfhydryl oxidase Erv1p

SCOPe Domain Sequences for d2hj3b_:

Sequence; same for both SEQRES and ATOM records:

>d2hj3b_ a.24.15.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pvtkedlgratwtflhtlaaqypekptrqqkkdvkelmtilsrmypcrecadhfkeilrs
npaqagsqeefsqwlchvhntvnrslgklvfpcervdarw

Timeline for d2hj3b_:

• d2hj3b_ is new in SCOPe 2.01-stable
  
• d2hj3b_ appears in SCOPe 2.02
  
• d2hj3b_ appears in the current release, SCOPe 2.08