Lineage for d2hj3a_ (2hj3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700461Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 2700493Family a.24.15.0: automated matches [191449] (1 protein)
    not a true family
  6. 2700494Protein automated matches [190684] (3 species)
    not a true protein
  7. 2700505Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187812] (1 PDB entry)
  8. 2700506Domain d2hj3a_: 2hj3 A: [165120]
    automated match to d1oqca_
    complexed with fad, so4

Details for d2hj3a_

PDB Entry: 2hj3 (more details), 2.5 Å

PDB Description: Structure of the Arabidopsis Thaliana Erv1 Thiol Oxidase
PDB Compounds: (A:) Sulfhydryl oxidase Erv1p

SCOPe Domain Sequences for d2hj3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hj3a_ a.24.15.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pvtkedlgratwtflhtlaaqypekptrqqkkdvkelmtilsrmypcrecadhfkeilrs
npaqagsqeefsqwlchvhntvnrslgklvfpcervdarwg

SCOPe Domain Coordinates for d2hj3a_:

Click to download the PDB-style file with coordinates for d2hj3a_.
(The format of our PDB-style files is described here.)

Timeline for d2hj3a_: