Class a: All alpha proteins [46456] (289 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) duplication: consists of two domains of this fold automatically mapped to Pfam PF02964 |
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries) |
Domain d1mmog_: 1mmo G: [16512] Other proteins in same PDB: d1mmob_, d1mmoc_, d1mmod_, d1mmoe_ complexed with acy, fe |
PDB Entry: 1mmo (more details), 2.2 Å
SCOPe Domain Sequences for d1mmog_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmog_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]} lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh
Timeline for d1mmog_: