![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
![]() | Superfamily d.24.1: Pili subunits [54523] (8 families) ![]() bacterial filament proteins |
![]() | Family d.24.1.1: Pilin [54524] (5 proteins) |
![]() | Protein automated matches [190127] (3 species) not a true protein |
![]() | Species Neisseria gonorrhoeae [TaxId:485] [187810] (1 PDB entry) |
![]() | Domain d2hi2a_: 2hi2 A: [165119] automated match to d1ay2a_ complexed with hto, ope |
PDB Entry: 2hi2 (more details), 2.3 Å
SCOPe Domain Sequences for d2hi2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hi2a_ d.24.1.1 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 485]} ftlielmiviaivgilaavalpayqdytaraqvseaillaegqksavteyylnhgkwpen ntsagvassptdikgkyvkevevkngvvtatmlssgvnneikgkklslwarrengsvkwf cgqpvtrtdddtvadakdgkeidtkhlpstcrdnfdak
Timeline for d2hi2a_: