Lineage for d2hi2a_ (2hi2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941191Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2941192Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2941193Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 2941214Protein automated matches [190127] (3 species)
    not a true protein
  7. 2941215Species Neisseria gonorrhoeae [TaxId:485] [187810] (1 PDB entry)
  8. 2941216Domain d2hi2a_: 2hi2 A: [165119]
    automated match to d1ay2a_
    complexed with hto, ope

Details for d2hi2a_

PDB Entry: 2hi2 (more details), 2.3 Å

PDB Description: crystal structure of native neisseria gonorrhoeae type iv pilin at 2.3 angstroms resolution
PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d2hi2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hi2a_ d.24.1.1 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
ftlielmiviaivgilaavalpayqdytaraqvseaillaegqksavteyylnhgkwpen
ntsagvassptdikgkyvkevevkngvvtatmlssgvnneikgkklslwarrengsvkwf
cgqpvtrtdddtvadakdgkeidtkhlpstcrdnfdak

SCOPe Domain Coordinates for d2hi2a_:

Click to download the PDB-style file with coordinates for d2hi2a_.
(The format of our PDB-style files is described here.)

Timeline for d2hi2a_: