Lineage for d2hi0b_ (2hi0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920534Species Lactobacillus delbrueckii [TaxId:1584] [187809] (1 PDB entry)
  8. 2920536Domain d2hi0b_: 2hi0 B: [165116]
    Other proteins in same PDB: d2hi0a2
    automated match to d2hsza1
    complexed with act, cl, edo, na

Details for d2hi0b_

PDB Entry: 2hi0 (more details), 1.51 Å

PDB Description: crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution
PDB Compounds: (B:) Putative phosphoglycolate phosphatase

SCOPe Domain Sequences for d2hi0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hi0b_ c.108.1.0 (B:) automated matches {Lactobacillus delbrueckii [TaxId: 1584]}
mkykaaifdmdgtildtsadltsalnyafeqtghrhdftvediknffgsgvvvavtrala
yeagssreslvafgtkdeqipeavtqtevnrvlevfkpyyadhcqiktgpfpgildlmkn
lrqkgvklavvsnkpneavqvlveelfpgsfdfalgeksgirrkpapdmtsecvkvlgvp
rdkcvyigdseidiqtarnsemdeiavnwgfrsvpflqkhgatvivdtaekleeailge

SCOPe Domain Coordinates for d2hi0b_:

Click to download the PDB-style file with coordinates for d2hi0b_.
(The format of our PDB-style files is described here.)

Timeline for d2hi0b_: