SCOPe 2.05: Domain d2hi0a_: 2hi0 A:

Lineage for d2hi0a_ (2hi0 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (49 species)
   not a true protein

7. Species Lactobacillus delbrueckii [TaxId:1584] [187809] (1 PDB entry)

8. Domain d2hi0a_: 2hi0 A: [165115]
   automated match to d2hsza1
   complexed with act, cl, edo, na

Details for d2hi0a_

PDB Entry: 2hi0, 1.51 Å

PDB Description: crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution

PDB Compounds: (A:) Putative phosphoglycolate phosphatase

SCOPe Domain Sequences for d2hi0a_:

Sequence; same for both SEQRES and ATOM records:

>d2hi0a_ c.108.1.0 (A:) automated matches {Lactobacillus delbrueckii [TaxId: 1584]}
gmkykaaifdmdgtildtsadltsalnyafeqtghrhdftvediknffgsgvvvavtral
ayeagssreslvafgtkdeqipeavtqtevnrvlevfkpyyadhcqiktgpfpgildlmk
nlrqkgvklavvsnkpneavqvlveelfpgsfdfalgeksgirrkpapdmtsecvkvlgv
prdkcvyigdseidiqtarnsemdeiavnwgfrsvpflqkhgatvivdtaekleeailge

Timeline for d2hi0a_:

• d2hi0a_ first appeared in SCOPe 2.01
  
• d2hi0a_ appears in SCOPe 2.04
  
• d2hi0a_ is called d2hi0a1 in SCOPe 2.06
  
• d2hi0a_ appears in the current release, SCOPe 2.08, called d2hi0a1