SCOPe 2.06: Domain d2hhld_: 2hhl D:

Lineage for d2hhld_ (2hhl D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins)
   Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet;

6. Protein automated matches [190659] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187808] (8 PDB entries)

8. Domain d2hhld_: 2hhl D: [165114]
   Other proteins in same PDB: d2hhlc2
   automated match to d1ta0a_
   complexed with keg

Details for d2hhld_

PDB Entry: 2hhl, 2.1 Å

PDB Description: crystal structure of the human small ctd phosphatase 3 isoform 1

PDB Compounds: (D:) CTD small phosphatase-like protein

SCOPe Domain Sequences for d2hhld_:

Sequence; same for both SEQRES and ATOM records:

>d2hhld_ c.108.1.16 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akyllpevtvldygkkcvvidldetlvhssfkpisnadfivpveidgtihqvyvlkrphv
deflqrmgqlfecvlftaslakyadpvadlldrwgvfrarlfrescvfhrgnyvkdlsrl
grelskviivdnspasyifhpenavpvqswfddmtdtelldlipffeglsre

Timeline for d2hhld_:

• d2hhld_ first appeared in SCOPe 2.01
  
• d2hhld_ appears in SCOPe 2.05
  
• d2hhld_ appears in SCOPe 2.07
  
• d2hhld_ appears in the current release, SCOPe 2.08