Lineage for d2hhld_ (2hhl D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920127Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins)
    Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet;
  6. 2920132Protein automated matches [190659] (1 species)
    not a true protein
  7. 2920133Species Human (Homo sapiens) [TaxId:9606] [187808] (8 PDB entries)
  8. 2920143Domain d2hhld_: 2hhl D: [165114]
    Other proteins in same PDB: d2hhlc2
    automated match to d1ta0a_
    complexed with keg

Details for d2hhld_

PDB Entry: 2hhl (more details), 2.1 Å

PDB Description: crystal structure of the human small ctd phosphatase 3 isoform 1
PDB Compounds: (D:) CTD small phosphatase-like protein

SCOPe Domain Sequences for d2hhld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhld_ c.108.1.16 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akyllpevtvldygkkcvvidldetlvhssfkpisnadfivpveidgtihqvyvlkrphv
deflqrmgqlfecvlftaslakyadpvadlldrwgvfrarlfrescvfhrgnyvkdlsrl
grelskviivdnspasyifhpenavpvqswfddmtdtelldlipffeglsre

SCOPe Domain Coordinates for d2hhld_:

Click to download the PDB-style file with coordinates for d2hhld_.
(The format of our PDB-style files is described here.)

Timeline for d2hhld_: