SCOPe 2.08: Domain d2hgxb_: 2hgx B:

Lineage for d2hgxb_ (2hgx B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)

6. Protein Branched-chain aminoacid aminotransferase [56757] (2 species)

7. Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (26 PDB entries)

8. Domain d2hgxb_: 2hgx B: [165108]
   automated match to d1ekfa_
   complexed with acy, epe, plp; mutant

Details for d2hgxb_

PDB Entry: 2hgx, 1.8 Å

PDB Description: crystal structure of cys315ala mutant of human mitochondrial branched chain aminotransferase

PDB Compounds: (B:) Branched-chain-amino-acid aminotransferase, mitochondrial

SCOPe Domain Sequences for d2hgxb_:

Sequence; same for both SEQRES and ATOM records:

>d2hgxb_ e.17.1.1 (B:) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
rlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvtpv
slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn
ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee
grvrevfgsgtaaqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm
fpv

Timeline for d2hgxb_:

• d2hgxb_ first appeared in SCOPe 2.01
  
• d2hgxb_ appears in SCOPe 2.07