Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins) |
Protein Branched-chain aminoacid aminotransferase [56757] (2 species) |
Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (26 PDB entries) |
Domain d2hgxb_: 2hgx B: [165108] automated match to d1ekfa_ complexed with acy, epe, plp; mutant |
PDB Entry: 2hgx (more details), 1.8 Å
SCOPe Domain Sequences for d2hgxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgxb_ e.17.1.1 (B:) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir rlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvtpv slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee grvrevfgsgtaaqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm fpv
Timeline for d2hgxb_: