SCOPe 2.01: Domain d2hfwa_: 2hfw A:

Lineage for d2hfwa_ (2hfw A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)

6. Protein automated matches [190681] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (10 PDB entries)

8. Domain d2hfwa_: 2hfw A: [165100]
   automated match to d1flja_
   complexed with zn

Details for d2hfwa_

PDB Entry: 2hfw, 2.5 Å

PDB Description: structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase iii

PDB Compounds: (A:) Carbonic anhydrase 3

SCOPe Domain Sequences for d2hfwa_:

Sequence; same for both SEQRES and ATOM records:

>d2hfwa_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktilnng
htcnvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlvhw
npkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdpssl
fpasrdywtyqgsfttppceecivwlllkepmtvssdqmaklrsllssaeneppvplvsn
wrppqpinnrvvrasfk

Timeline for d2hfwa_:

• d2hfwa_ is new in SCOPe 2.01-stable
  
• d2hfwa_ appears in SCOPe 2.02
  
• d2hfwa_ appears in the current release, SCOPe 2.08