Lineage for d2hfoe_ (2hfo E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416569Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 1416635Family d.58.10.0: automated matches [191394] (1 protein)
    not a true family
  6. 1416636Protein automated matches [190511] (5 species)
    not a true protein
  7. 1416651Species Synechocystis sp. PCC 6803 [TaxId:1148] [187803] (2 PDB entries)
  8. 1416656Domain d2hfoe_: 2hfo E: [165094]
    automated match to d1x0pb1
    complexed with fmn

Details for d2hfoe_

PDB Entry: 2hfo (more details), 2.1 Å

PDB Description: Crystal Structures of the Synechocystis Photoreceptor Slr1694 Reveal Distinct Structural States Related to Signaling
PDB Compounds: (E:) Activator of photopigment and puc expression

SCOPe Domain Sequences for d2hfoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfoe_ d.58.10.0 (E:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
psamdpeqclnflldiakiye

SCOPe Domain Coordinates for d2hfoe_:

Click to download the PDB-style file with coordinates for d2hfoe_.
(The format of our PDB-style files is described here.)

Timeline for d2hfoe_: