Lineage for d2hfoc_ (2hfo C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953403Family d.58.10.0: automated matches [191394] (1 protein)
    not a true family
  6. 2953404Protein automated matches [190511] (8 species)
    not a true protein
  7. 2953433Species Synechocystis sp. PCC 6803 [TaxId:1148] [187803] (2 PDB entries)
  8. 2953436Domain d2hfoc_: 2hfo C: [165092]
    automated match to d1x0pb1
    complexed with fmn

Details for d2hfoc_

PDB Entry: 2hfo (more details), 2.1 Å

PDB Description: Crystal Structures of the Synechocystis Photoreceptor Slr1694 Reveal Distinct Structural States Related to Signaling
PDB Compounds: (C:) Activator of photopigment and puc expression

SCOPe Domain Sequences for d2hfoc_:

Sequence, based on SEQRES records: (download)

>d2hfoc_ d.58.10.0 (C:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
psamdpeqclnflldiakiye

Sequence, based on observed residues (ATOM records): (download)

>d2hfoc_ d.58.10.0 (C:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
etyhrivqderhhspqiiecmpirrrnfevwsmqaisteqvktlvlkysgfttlrpsamd
peqclnflldiakiye

SCOPe Domain Coordinates for d2hfoc_:

Click to download the PDB-style file with coordinates for d2hfoc_.
(The format of our PDB-style files is described here.)

Timeline for d2hfoc_: