Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) |
Family d.58.10.0: automated matches [191394] (1 protein) not a true family |
Protein automated matches [190511] (4 species) not a true protein |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [187803] (1 PDB entry) |
Domain d2hfoa_: 2hfo A: [165090] automated match to d1x0pb1 complexed with fmn |
PDB Entry: 2hfo (more details), 2.1 Å
SCOPe Domain Sequences for d2hfoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hfoa_ d.58.10.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]} mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr psamdpeqclnflldiakiyelsdnffldl
Timeline for d2hfoa_: