Lineage for d2hfna_ (2hfn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953403Family d.58.10.0: automated matches [191394] (1 protein)
    not a true family
  6. 2953404Protein automated matches [190511] (8 species)
    not a true protein
  7. 2953450Species Synechocystis sp. [TaxId:1143] [187802] (1 PDB entry)
  8. 2953451Domain d2hfna_: 2hfn A: [165080]
    automated match to d1x0pb1
    complexed with fmn

Details for d2hfna_

PDB Entry: 2hfn (more details), 1.8 Å

PDB Description: Crystal Structures of the Synechocystis Photoreceptor Slr1694 Reveal Distinct Structural States Related to Signaling
PDB Compounds: (A:) Synechocystis Photoreceptor (Slr1694)

SCOPe Domain Sequences for d2hfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfna_ d.58.10.0 (A:) automated matches {Synechocystis sp. [TaxId: 1143]}
slyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
samdpeqclnflldiakiyelsdnffldl

SCOPe Domain Coordinates for d2hfna_:

Click to download the PDB-style file with coordinates for d2hfna_.
(The format of our PDB-style files is described here.)

Timeline for d2hfna_: