Lineage for d1fyze_ (1fyz E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535400Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
    core: 3 helices; bundle, open
  4. 535431Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 535432Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 535433Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 535434Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)
  8. 535445Domain d1fyze_: 1fyz E: [16508]
    Other proteins in same PDB: d1fyza_, d1fyzb_, d1fyzc_, d1fyzd_

Details for d1fyze_

PDB Entry: 1fyz (more details), 2.15 Å

PDB Description: methane monooxygenase hydroxylase, form ii reduced by soaking
PDB Compounds: (E:)

SCOP Domain Sequences for d1fyze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyze_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

SCOP Domain Coordinates for d1fyze_:

Click to download the PDB-style file with coordinates for d1fyze_.
(The format of our PDB-style files is described here.)

Timeline for d1fyze_: