SCOPe 2.05: Domain d2hf2b_: 2hf2 B:

Lineage for d2hf2b_ (2hf2 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein automated matches [190498] (5 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187804] (1 PDB entry)

8. Domain d2hf2b_: 2hf2 B: [165078]
   automated match to d1rlma_

Details for d2hf2b_

PDB Entry: 2hf2, 1.9 Å

PDB Description: domain shifting confirms monomeric structure of escherichia sugar phosphatase suph

PDB Compounds: (B:) Sugar phosphatase supH

SCOPe Domain Sequences for d2hf2b_:

Sequence; same for both SEQRES and ATOM records:

>d2hf2b_ c.108.1.10 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lsvkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasnnqyyqlisffpelkd
eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
qiaryatddnnhegalnviqavldntspfn

Timeline for d2hf2b_:

• d2hf2b_ first appeared in SCOPe 2.01
  
• d2hf2b_ appears in SCOPe 2.04
  
• d2hf2b_ appears in SCOPe 2.06
  
• d2hf2b_ appears in the current release, SCOPe 2.08