Lineage for d2hf2b_ (2hf2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919946Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2920018Protein automated matches [190498] (5 species)
    not a true protein
  7. 2920019Species Escherichia coli K-12 [TaxId:83333] [187804] (1 PDB entry)
  8. 2920021Domain d2hf2b_: 2hf2 B: [165078]
    automated match to d1rlma_

Details for d2hf2b_

PDB Entry: 2hf2 (more details), 1.9 Å

PDB Description: domain shifting confirms monomeric structure of escherichia sugar phosphatase suph
PDB Compounds: (B:) Sugar phosphatase supH

SCOPe Domain Sequences for d2hf2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hf2b_ c.108.1.10 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lsvkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasnnqyyqlisffpelkd
eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
qiaryatddnnhegalnviqavldntspfn

SCOPe Domain Coordinates for d2hf2b_:

Click to download the PDB-style file with coordinates for d2hf2b_.
(The format of our PDB-style files is described here.)

Timeline for d2hf2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hf2a_