Lineage for d2hf2a_ (2hf2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2148975Family c.108.1.10: Predicted hydrolases Cof [82388] (12 protein domains)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2149046Protein automated matches [190498] (5 species)
    not a true protein
  7. 2149047Species Escherichia coli K-12 [TaxId:83333] [187804] (1 PDB entry)
  8. 2149048Domain d2hf2a_: 2hf2 A: [165077]
    automated match to d1rlma_

Details for d2hf2a_

PDB Entry: 2hf2 (more details), 1.9 Å

PDB Description: Domain shifting confirms monomeric structure of Escherichia sugar phosphatase SUPH
PDB Compounds: (A:) Sugar phosphatase supH

SCOPe Domain Sequences for d2hf2a_:

Sequence, based on SEQRES records: (download)

>d2hf2a_ c.108.1.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lsvkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasnnqyyqlisffpelkd
eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
qiaryatddnnhegalnviqavldntspfn

Sequence, based on observed residues (ATOM records): (download)

>d2hf2a_ c.108.1.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lsvkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasnnqyyqlisffpelkd
eisfvaengalvyehgkqlfhgeltrhesrivigellknfvacglqsayvsenapeafva
lmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgfid
liipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikqiar
yatddnnhegalnviqavldntspfn

SCOPe Domain Coordinates for d2hf2a_:

Click to download the PDB-style file with coordinates for d2hf2a_.
(The format of our PDB-style files is described here.)

Timeline for d2hf2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hf2b_