SCOPe 2.08: Domain d2heod_: 2heo D:

Lineage for d2heod_ (2heo D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
   Pfam PF02295

6. Protein automated matches [190680] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187801] (1 PDB entry)

8. Domain d2heod_: 2heo D: [165076]
   automated match to d1j75a_
   protein/DNA complex

Details for d2heod_

PDB Entry: 2heo, 1.7 Å

PDB Description: general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers.

PDB Compounds: (D:) Z-DNA binding protein 1

SCOPe Domain Sequences for d2heod_:

Sequence; same for both SEQRES and ATOM records:

>d2heod_ a.4.5.19 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dnleqkilqvlsddggpvaifqlvkkcqvpkktlnqvlyrlkkedrvsspspkywsig

Timeline for d2heod_:

• d2heod_ first appeared in SCOPe 2.01
  
• d2heod_ appears in SCOPe 2.07