Lineage for d2heod_ (2heo D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693367Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 2693400Protein automated matches [190680] (2 species)
    not a true protein
  7. 2693411Species Mouse (Mus musculus) [TaxId:10090] [187801] (1 PDB entry)
  8. 2693413Domain d2heod_: 2heo D: [165076]
    automated match to d1j75a_
    protein/DNA complex

Details for d2heod_

PDB Entry: 2heo (more details), 1.7 Å

PDB Description: general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers.
PDB Compounds: (D:) Z-DNA binding protein 1

SCOPe Domain Sequences for d2heod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heod_ a.4.5.19 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dnleqkilqvlsddggpvaifqlvkkcqvpkktlnqvlyrlkkedrvsspspkywsig

SCOPe Domain Coordinates for d2heod_:

Click to download the PDB-style file with coordinates for d2heod_.
(The format of our PDB-style files is described here.)

Timeline for d2heod_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2heoa_