![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187169] (30 PDB entries) |
![]() | Domain d2hela_: 2hel A: [165074] automated match to d1jpaa_ mutant |
PDB Entry: 2hel (more details), 2.35 Å
SCOPe Domain Sequences for d2hela_:
Sequence, based on SEQRES records: (download)
>d2hela_ d.144.1.7 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} akeidascikiekvigvgefgevcsgrlkvpgkreicvaiktlkagytdkqrrdflseas imgqfdhpniihlegvvtkckpvmiiteymengsldaflrkndgrftviqlvgmlrgigs gmkylsdmsavhrdlaarnilvnsnlvckvsdfgmsrvleddpeaayttrggkipirwta peaiayrkftsasdvwsygivmwevmsygerpywdmsnqdvikaieegyrlpppmdcpia lhqlmldcwqkersdrpkfgqivnmldklirnpnsl
>d2hela_ d.144.1.7 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} akeidascikiekvigvgefgevcsgrlkveicvaiktlkytdkqrrdflseasimgqfd hpniihlegvvtkckpvmiiteymengsldaflrkndgrftviqlvgmlrgigsgmkyls dmsavhrdlaarnilvnsnlvckvsdfgmsrvkipirwtapeaiayrkftsasdvwsygi vmwevmsygerpywdmsnqdvikaieegyrlpppmdcpialhqlmldcwqkersdrpkfg qivnmldklirnpnsl
Timeline for d2hela_: