SCOPe 2.05: Domain d2hejb_: 2hej B:

Lineage for d2hejb_ (2hej B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein automated matches [190169] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187524] (11 PDB entries)

8. Domain d2hejb_: 2hej B: [165073]
   automated match to d1mrqa_
   complexed with bme, edo, mpd, ndp

Details for d2hejb_

PDB Entry: 2hej, 1.35 Å

PDB Description: Crystal structure of 17alpha-hydroxysteroid dehydrogenase in complex with NADP(H) in a closed conformation

PDB Compounds: (B:) Aldo-keto reductase family 1, member C21

SCOPe Domain Sequences for d2hejb_:

Sequence; same for both SEQRES and ATOM records:

>d2hejb_ c.1.7.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hcvilndgnfipvlgfgtalplecpkskakeltkiaidagfhhfdsasvyntedhvgeai
rskiadgtvrredifytskvwctslhpelvraslerslqklqfdyvdlylihypmalkpg
eenfpvdehgklifdrvdlcatweamekckdagltksigvsnfnyrqlemilnkpglkyk
pvcnqvechpylnqmklldfckskdivlvaygvlgtqryggwvdqnspvlldepvlgsma
kkynrtpalialryqlqrgivvlntslkeerikenmqvfefqlssedmkvldglnrnmry
ipaaifkghpnwpfldey

Timeline for d2hejb_:

• d2hejb_ first appeared in SCOPe 2.01
  
• d2hejb_ appears in SCOPe 2.04
  
• d2hejb_ appears in SCOPe 2.06
  
• d2hejb_ appears in the current release, SCOPe 2.08