Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein automated matches [190169] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187524] (11 PDB entries) |
Domain d2heja_: 2hej A: [165072] automated match to d1mrqa_ complexed with bme, edo, mpd, ndp |
PDB Entry: 2hej (more details), 1.35 Å
SCOPe Domain Sequences for d2heja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2heja_ c.1.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} hcvilndgnfipvlgfgtalplecpkskakeltkiaidagfhhfdsasvyntedhvgeai rskiadgtvrredifytskvwctslhpelvraslerslqklqfdyvdlylihypmalkpg eenfpvdehgklifdrvdlcatweamekckdagltksigvsnfnyrqlemilnkpglkyk pvcnqvechpylnqmklldfckskdivlvaygvlgtqryggwvdqnspvlldepvlgsma kkynrtpalialryqlqrgivvlntslkeerikenmqvfefqlssedmkvldglnrnmry ipaaifkghpnwpfldey
Timeline for d2heja_: