Lineage for d2heia_ (2hei A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868219Domain d2heia_: 2hei A: [165070]
    automated match to d1r2qa_
    complexed with d1d, gdp

Details for d2heia_

PDB Entry: 2hei (more details), 1.55 Å

PDB Description: crystal structure of human rab5b in complex with gdp
PDB Compounds: (A:) Ras-related protein Rab-5B

SCOPe Domain Sequences for d2heia_:

Sequence, based on SEQRES records: (download)

>d2heia_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqsvclddttvkfeiwdta
gqeryhslapmyyrgaqaaivvyditnqetfaraktwvkelqrqaspsivialagnkadl
ankrmveyeeaqayaddnsllfmetsaktamnvndlflaiakklpk

Sequence, based on observed residues (ATOM records): (download)

>d2heia_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqsvcltvkfeiwdtagqe
ryhslapmyyrgaqaaivvyditnqetfaraktwvkelqrqaspsivialagnkadlank
rmveyeeaqayaddnsllfmetsaktamnvndlflaiakklpk

SCOPe Domain Coordinates for d2heia_:

Click to download the PDB-style file with coordinates for d2heia_.
(The format of our PDB-style files is described here.)

Timeline for d2heia_: