SCOP 1.75: Domain d1fz0f_: 1fz0 F:

Lineage for d1fz0f_ (1fz0 F:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)

8. Domain d1fz0f_: 1fz0 F: [16507]
   Other proteins in same PDB: d1fz0a_, d1fz0b_, d1fz0c_, d1fz0d_
   complexed with ca, fe2

Details for d1fz0f_

PDB Entry: 1fz0, 2.07 Å

PDB Description: methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically

PDB Compounds: (F:) methane monooxygenase component a, gamma chain

SCOP Domain Sequences for d1fz0f_:

Sequence; same for both SEQRES and ATOM records:

>d1fz0f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph

Timeline for d1fz0f_:

• d1fz0f_ first appeared (with stable ids) in SCOP 1.55
  
• d1fz0f_ appears in SCOP 1.73
  
• d1fz0f_ appears in SCOPe 2.01
  
• d1fz0f_ appears in the current release, SCOPe 2.08