Lineage for d2he5d_ (2he5 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081255Protein automated matches [190169] (5 species)
    not a true protein
  7. 2081331Species Mouse (Mus musculus) [TaxId:10090] [187524] (12 PDB entries)
  8. 2081362Domain d2he5d_: 2he5 D: [165067]
    automated match to d1mrqa_
    complexed with act, bme, ndp

Details for d2he5d_

PDB Entry: 2he5 (more details), 2.9 Å

PDB Description: Crystal structure of 17alpha-hydroxysteroid dehydrogenase in binary complex with NADP(H) in an open conformation
PDB Compounds: (D:) Aldo-keto reductase family 1, member C21

SCOPe Domain Sequences for d2he5d_:

Sequence, based on SEQRES records: (download)

>d2he5d_ c.1.7.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hcvilndgnfipvlgfgtalplecpkskakeltkiaidagfhhfdsasvyntedhvgeai
rskiadgtvrredifytskvwctslhpelvraslerslqklqfdyvdlylihypmalkpg
eenfpvdehgklifdrvdlcatweamekckdagltksigvsnfnyrqlemilnkpglkyk
pvcnqvechpylnqmklldfckskdivlvaygvlgtqryggwvdqnspvlldepvlgsma
kkynrtpalialryqlqrgivvlntslkeerikenmqvfefqlssedmkvldglnrnmry
ipaaifkghpnwpfldey

Sequence, based on observed residues (ATOM records): (download)

>d2he5d_ c.1.7.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hcvilndgnfipvlgfgtalplecpkskakeltkiaidagfhhfdsasvyntedhvgeai
rskiadgtvrredifytskvwctslhpelvraslerslqklqfdyvdlylihypmalkpg
eenfpvdehgklifdrvdlcatweamekckdagltksigvsnfnyrqlemilnkpglkyk
pvcnqvechpylnqmklldfckskdivlvaygvlgtgwvdqnspvlldepvlgsmakkyn
rtpalialryqlqrgivvlntslkeerikenmqvfefqlssedmkvldglnrnmryipaa
ifkghpnwpfldey

SCOPe Domain Coordinates for d2he5d_:

Click to download the PDB-style file with coordinates for d2he5d_.
(The format of our PDB-style files is described here.)

Timeline for d2he5d_: