Lineage for d2hdza_ (2hdz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725579Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1725580Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1725581Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 1725638Protein automated matches [190434] (3 species)
    not a true protein
  7. 1725647Species Human (Homo sapiens) [TaxId:9606] [187328] (5 PDB entries)
  8. 1725648Domain d2hdza_: 2hdz A: [165062]
    automated match to d1l8ya_

Details for d2hdza_

PDB Entry: 2hdz (more details), 2 Å

PDB Description: crystal structure analysis of the ubf hmg box5
PDB Compounds: (A:) Nucleolar transcription factor 1

SCOPe Domain Sequences for d2hdza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hdza_ a.21.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedqkr
yerels

SCOPe Domain Coordinates for d2hdza_:

Click to download the PDB-style file with coordinates for d2hdza_.
(The format of our PDB-style files is described here.)

Timeline for d2hdza_: