| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
| Family a.21.1.1: HMG-box [47096] (10 proteins) |
| Protein automated matches [190434] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187328] (5 PDB entries) |
| Domain d2hdza_: 2hdz A: [165062] automated match to d1l8ya_ |
PDB Entry: 2hdz (more details), 2 Å
SCOPe Domain Sequences for d2hdza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hdza_ a.21.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedqkr
yerels
Timeline for d2hdza_: