SCOPe 2.03: Domain d2hdxe_: 2hdx E:

Lineage for d2hdxe_ (2hdx E:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187800] (4 PDB entries)

8. Domain d2hdxe_: 2hdx E: [165060]
   automated match to d1rpyb_

Details for d2hdxe_

PDB Entry: 2hdx, 2.35 Å

PDB Description: crystal structure of the src homology-2 domain of sh2-b in complex with jak2 ptyr813 phosphopeptide

PDB Compounds: (E:) SH2-B PH domain containing signaling mediator 1 gamma isoform

SCOPe Domain Sequences for d2hdxe_:

Sequence; same for both SEQRES and ATOM records:

>d2hdxe_ d.93.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhlrl
slnaagqcrvqhlhfqsifdmlehfrvhpiplesggssdvvlvsyvps

Timeline for d2hdxe_:

• d2hdxe_ first appeared in SCOPe 2.01
  
• d2hdxe_ appears in SCOPe 2.02
  
• d2hdxe_ appears in SCOPe 2.04
  
• d2hdxe_ appears in the current release, SCOPe 2.08