Lineage for d1fz0e_ (1fz0 E:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765254Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 765285Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 765286Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 765287Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 765288Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 765303Domain d1fz0e_: 1fz0 E: [16506]
    Other proteins in same PDB: d1fz0a_, d1fz0b_, d1fz0c_, d1fz0d_

Details for d1fz0e_

PDB Entry: 1fz0 (more details), 2.07 Å

PDB Description: methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically
PDB Compounds: (E:) methane monooxygenase component a, gamma chain

SCOP Domain Sequences for d1fz0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz0e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

SCOP Domain Coordinates for d1fz0e_:

Click to download the PDB-style file with coordinates for d1fz0e_.
(The format of our PDB-style files is described here.)

Timeline for d1fz0e_: